PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H00055.1.p
Common NameEUGRSUZ_H00055, LOC104456029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 314aa    MW: 33816.3 Da    PI: 6.5119
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H00055.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.9e-3349103155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Eucgr.H00055.1.p  49 KPRLRWTAELHDRFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 103
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.63946106IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-3246104IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-2449104IPR006447Myb domain, plants
SuperFamilySSF466898.42E-1749105IPR009057Homeodomain-like
PfamPF002491.5E-751101IPR001005SANT/Myb domain
PfamPF143791.6E-27146191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYQALHSLPL DGGGVGVGVG PSGDFRGDFD GAGHGLAGDA CLVLTADPKP RLRWTAELHD  60
RFVDAVTQLG GPDKATPKTI MRTMGVKGLT LYHLKSHLQK FRLGKQSGKD SSGNSKDAPC  120
DTDSLNTGSS ATSSSGILTQ ELNDYRVTEA LRVQMEVQRR LHEQLEVQRH LQLRIEAQGK  180
YLQSILEKAC KVLNDQVAVP AGLEEARDEL SELAIKVSND YPGVRAVDTL KMPCFSELAA  240
ALDSTSLSGL PSWLGDGSAE SCLTSLDSSI SPNAIGSHVI SVKKRLRPVF GNRELLPMES  300
STQKQVDWMM NNM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H00055.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1195884e-33AK119588.1 Oryza sativa Japonica Group cDNA clone:002-117-C12, full insert sequence.
GenBankCT8417604e-33CT841760.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C103B02, full insert sequence.
GenBankKJ7280524e-33KJ728052.1 Zea mays clone pUT6198 G2-like transcription factor (GLK53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069039.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK51e-68APL_ARATH; Myb family transcription factor APL
TrEMBLA0A059AUZ10.0A0A059AUZ1_EUCGR; Uncharacterized protein
STRINGVIT_05s0029g00060.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-106G2-like family protein